PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS72786.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family WOX
Protein Properties Length: 160aa    MW: 18610.1 Da    PI: 11.115
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS72786.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox70.52e-2259117356
                 --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHH CS
    Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakek 56 
                 +R+++t+eql++Leel+++ +r+psa+++++++++l    +++ ++V++WFqN++a+e+
  EPS72786.1  59 SRWNPTPEQLQTLEELYRRgTRTPSADQIQQITAELrrfgKIEGKNVFYWFQNHKARER 117
                 7*****************99*************************************98 PP

2Wus_type_Homeobox115.82.1e-3758119364
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                        ++RW+PtpeQ++ Leely++G+rtP++++iq+itaeL+++Gkie+kNVfyWFQN+kaRer k
         EPS72786.1  58 SSRWNPTPEQLQTLEELYRRGTRTPSADQIQQITAELRRFGKIEGKNVFYWFQNHKARERLK 119
                        79**********************************************************88 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003897.2E-556123IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.4E-959117IPR009057Homeodomain-like
SuperFamilySSF466891.18E-1259125IPR009057Homeodomain-like
PfamPF000463.9E-2059117IPR001356Homeobox domain
CDDcd000865.77E-660117No hitNo description
PROSITE profilePS5007110.91664119IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048513Biological Processanimal organ development
GO:0099402Biological Processplant organ development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
MTMGFDGGKD SLAGRRLRPL MPRPSNHGCD FLPRLGAAIV EQNGKARELV NSQQVVVSSR  60
WNPTPEQLQT LEELYRRGTR TPSADQIQQI TAELRRFGKI EGKNVFYWFQ NHKARERLKR  120
RRQMDQHSPE KGEQQQITGQ IPEIRNRNPK SAHDLFRIHD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006451629.14e-50hypothetical protein CICLE_v10008783mg
RefseqXP_006490833.24e-50PREDICTED: WUSCHEL-related homeobox 1-like
SwissprotQ6X7K05e-46WOX1_ARATH; WUSCHEL-related homeobox 1
TrEMBLS8D5T81e-117S8D5T8_9LAMI; Uncharacterized protein
STRINGGLYMA07G11372.16e-48(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46812342
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18010.13e-47WUSCHEL related homeobox 1
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]